Protein coding transcript 158873

• Transcript: Ll_transcript_107026
• CDS coordinates: 3-368 (+)
• Peptide sequence: TAFPSERLGLGAFRIALESIFNKIHHHPLEYTSFGKPHPSVFRNAETVLQQLVPQIHDDPHNNAQNFKTLYMIGDNPVVDIRGARQTGHPWFSILTRTGVFKGKGNHDQFPADLVILFTFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_107026

• Blastp: Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c from Schizosaccharomyces with 40.78% of identity
• Blastx: Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c from Schizosaccharomyces with 40.78% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC22A12.08c)
• CantataDB: Link to cantataDB annotations (CNT0002221)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447918.1)
• Pfam: HAD-hyrolase-like (PF13242.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;