Protein coding transcript 158874

• Transcript: Ll_transcript_107037
• CDS coordinates: 1278-1604 (+)
• Peptide sequence: MSEYGFKNVLSIDEYASLFENIDPLAPYKKWTTKLAAVQNAEFNEGAPRNDVFSERVKAAFVVSDPVDWSRDIQVLCDILKTGGLPGRNVGPQPHLYFANDDLEYQVG*
• ORF Type: complete

Annotations of Ll_transcript_107037

• Blastp: Haloacid dehalogenase-like hydrolase domain-containing 5 from Homo with 30.53% of identity
• Blastx: Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c from Schizosaccharomyces with 27.99% of identity
• Eggnog: Hydrolase(COG0647)
• Kegg: Link to kegg annotations (27440)
• CantataDB: Link to cantataDB annotations (CNT0002221)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447918.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;