Transcript | Ll_transcript_107032 |
---|---|
CDS coordinates | 281-844 (+) |
Peptide sequence | MINLFVFVYDSGRIRIPYVFLTNGGGFPEAKRAFELSQLLGINVSASQVLQGHSPFKQLVNRFENEFIVAVGKGQPAAVMSEYGFKNVLSIDEYASLFENIDPLAPYKKWTTKLAAVQNAEFNEGAPRNDVFSERVKAAFVVSDPVDWSRDIQVLCDILKTGGLPGRNVGPQPHLYFANDDLEYQVG* |
ORF Type | complete |
Blastp | Uncharacterized protein YKR070W from Saccharomyces with 33.52% of identity |
---|---|
Blastx | Uncharacterized protein YKR070W from Saccharomyces with 28.33% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YKR070W) |
CantataDB | Link to cantataDB annotations (CNT0002221) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447918.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13344.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer