Protein coding transcript 158892

• Transcript: Ll_transcript_106056
• CDS coordinates: 1242-1676 (+)
• Peptide sequence: MPSPNWPADKIKGEDCWTDLEYCREKGLYYPIAKTLAEKAGWDFAKETGFDVVMINPGTALGPLIPPRINSSMAVLVKVLKGDKETYEDFFMGTAHFKDIALAHILAYEKKNAAGRHLCVEAIRHYGDLVAKVAELYPEYNVAT*
• ORF Type: complete

Annotations of Ll_transcript_106056

• Blastp: Cinnamoyl-CoA reductase 1 from Arabidopsis with 40.43% of identity
• Blastx: Cinnamoyl-CoA reductase 1 from Arabidopsis with 41.34% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT1G15950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439258.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;