Protein coding transcript 158900

• Transcript: Ll_transcript_106084
• CDS coordinates: 2-319 (+)
• Peptide sequence: YVTTRVLGTFGYVAPEYACTGMLTEKSDVYSFGILIMEIITGRSPVDYGRPHGEVNLIDWLKKMVGNRKAEEVSDPKLPEKPSPKALKRALVVALRCVGHDATKRP
• ORF Type: internal

Annotations of Ll_transcript_106084

• Blastp: Probable serine/threonine-protein kinase At1g01540 from Arabidopsis with 81.13% of identity
• Blastx: Probable serine/threonine-protein kinase At1g01540 from Arabidopsis with 81.13% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G01540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420761.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;