Protein coding transcript 158904

• Transcript: Ll_transcript_106077
• CDS coordinates: 2-883 (+)
• Peptide sequence: FSNWNIHDTNPCKWTCITCSSLGFVTEINIESIPLQLPIPSNLSSFPFLKKLVFSDANLTGTIPFDIGDCSSLTALDLSSNNLVGSIPSSIGNLNNLVNLSLNSNQLTGKIPVEIRNCIGLKNLLLFDNQLGGSIPPELGKLLQLEVLRAGGNKDIAGKIPEELGECRNLTVLGLADTRISGSLPASLGKLKKLQTLSIYTTMLSGEIPPDLGNCSELVDLFLYENSLSGSLPSELGKLQKLEQLFLWKNSIIGAIPEEIGNCTSLRKFDLSLNSLSGTIPLSLGGLLKLEKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_106077

• Blastp: Receptor-like protein kinase 2 from Arabidopsis with 67.81% of identity
• Blastx: Receptor-like protein kinase 2 from Arabidopsis with 66.23% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G24240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462372.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;