Transcript | Ll_transcript_105528 |
---|---|
CDS coordinates | 148-636 (+) |
Peptide sequence | MNFRNMKVPNVPGGGAASALLKLGFVGGIGLYAAANSLYNVEGGHRAIVFNRLIGVKDKVYPEGTHFVVPWFERPVIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPLPSQLPTIYRTLGENYNERVLPSIIHETLKAVVAQYNASQLITQREVSSKVSV* |
ORF Type | complete |
Blastp | Prohibitin-2, mitochondrial from Arabidopsis with 79.08% of identity |
---|---|
Blastx | Prohibitin-6, mitochondrial from Arabidopsis with 75.47% of identity |
Eggnog | Band 7 protein(COG0330) |
Kegg | Link to kegg annotations (AT1G03860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431334.1) |
Pfam | SPFH domain / Band 7 family (PF01145.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer