Protein coding transcript 158930

• Transcript: Ll_transcript_105532
• CDS coordinates: 148-636 (+)
• Peptide sequence: MNFRNMKVPNVPGGGAASALLKLGFVGGIGLYAAANSLYNVEGGHRAIVFNRLIGVKDKVYPEGTHFVVPWFERPVIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPLPSQLPTIYRTLGENYNERVLPSIIHETLKAVVAQYNASQLITQREVSSKVSV*
• ORF Type: complete

Annotations of Ll_transcript_105532

• Blastp: Prohibitin-2, mitochondrial from Arabidopsis with 79.08% of identity
• Blastx: Prohibitin-6, mitochondrial from Arabidopsis with 75.47% of identity
• Eggnog: Band 7 protein(COG0330)
• Kegg: Link to kegg annotations (AT1G03860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431334.1)
• Pfam: SPFH domain / Band 7 family (PF01145.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;