Protein coding transcript 159

• Transcript: Ll_transcript_396708
• CDS coordinates: 1-420 (+)
• Peptide sequence: RIGDYDDDTPDYSSGALPLPAPNGKHDTNMSVMKRNQNGEFDHNRWLFETKGTYGVGNAYWPQDDMYGDDGDDGLRGGMIDPMDKPWKPLSRKTPIPSSIMSPYRLLIAIRLVVLAFFLQWRVVHPNKDAIWLWLMSIVC
• ORF Type: internal

Annotations of Ll_transcript_396708

• Blastp: Cellulose synthase-like protein D4 from Arabidopsis with 75% of identity
• Blastx: Cellulose synthase-like protein D4 from Arabidopsis with 74.13% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT4G38190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454873.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;