Protein coding transcript 159007

• Transcript: Ll_transcript_242122
• CDS coordinates: 313-1125 (+)
• Peptide sequence: MIATASIVPSMKIKIKLPTKRVEVDLGTKCGLSQKASQVEENGFFNSKERSSVPGSNKRGPQVSIESQQVKRQKMDRKASVQCTTILKSLMSQKHSWVFNKPVDPVALNIPDYFTVISQPMDLGTIKSKLDKNIYFSIEEFAVDVRLTFSNAMTYNPPSNDVHLMAKDLNKLFERKWKDLEKKWKCEDEHEKSMTGTVRETVNFFCNEMHPLQKDTLPKKLRVSKPKRNQKISSLAGRDAKVSVVFYKRCKANWNLQACNAFVVIDATKC*
• ORF Type: complete

Annotations of Ll_transcript_242122

• Blastp: Transcription factor GTE12 from Arabidopsis with 46.02% of identity
• Blastx: Transcription factor GTE12 from Arabidopsis with 46.02% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT5G46550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461350.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;