Transcript | Ll_transcript_413058 |
---|---|
CDS coordinates | 598-1536 (+) |
Peptide sequence | MEKYEKLQKVGEGTYGKVYKAIEKATGQIVALKKTRLEMDEEGIPPTALREVSLLQLLSQSIYIVRLLSVEHIDKVPKASTPSAQTKHILYLVFEYLDTDLKKFVDSYRKGPNPRPLPPSLIQSFLFQLCKGVAHCHSHGVLHRDLKPQNLLLDQQKGILKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEILLGSTHYSTGVDMWSVGCIFAEMARRQALFPGDSEFKQLLSIFKILGTPTEEQWPGVTSLRDWHVYPRWEPQNLARAVPSLGPHGVDLLTKMLKYNPAERISAKVALDHPYFDTLDKCQF* |
ORF Type | complete |
Blastp | Cyclin-dependent kinase B1-1 from Arabidopsis with 83.33% of identity |
---|---|
Blastx | Cyclin-dependent kinase B1-1 from Arabidopsis with 83.33% of identity |
Eggnog | Cyclin-Dependent Kinase(ENOG410XPP3) |
Kegg | Link to kegg annotations (AT3G54180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426991.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer