Protein coding transcript 159036

• Transcript: Ll_transcript_241592
• CDS coordinates: 314-619 (+)
• Peptide sequence: MATIGHNNLNAKLVLLGDMGAGKSSLVLRFVKGQFLEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNSDSFTRAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_241592

• Blastp: Ras-related protein RHN1 from Nicotiana with 92.16% of identity
• Blastx: Ras-related protein RHN1 from Nicotiana with 92.16% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460953.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;