| Transcript | Ll_transcript_395063 |
|---|---|
| CDS coordinates | 3-410 (+) |
| Peptide sequence | SKLFDVSGFVCVVTGGGTGIGLMCSQALAANGAKVYITGRRTEALEKAAKSHDPDHGGTIIPVGPTDVTKKDDIEALVKDLQTKEKYINLLICAAGIPGPKAEPEHDDADDLKKKLWDNESVQDWNDTYNTDVTSV |
| ORF Type | internal |
| Blastp | Uncharacterized oxidoreductase SAOUHSC_02778 from Staphylococcus with 37.93% of identity |
|---|---|
| Blastx | - |
| Eggnog | serine 3-dehydrogenase activity(COG4221) |
| Kegg | Link to kegg annotations (SAOUHSC_02778) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017441583.1) |
| Pfam | short chain dehydrogenase (PF00106.24) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer