Transcript | Ll_transcript_242616 |
---|---|
CDS coordinates | 284-706 (+) |
Peptide sequence | MQVSKELVNNGIAVEQIGVITPYNAQANLIRHAACMTSLEIHTIDKYQGRDKDCILVSFVRSSEGPTSSAASLLGDWHRINVALTRAKRKLIMVGSPRTLSKVPLLKLLIKKVERQSGILSVSKKDIFQTGELKRCSQLR* |
ORF Type | complete |
Blastp | DNA replication ATP-dependent helicase/nuclease dna2 from Schizosaccharomyces with 40.28% of identity |
---|---|
Blastx | DNA replication ATP-dependent helicase/nuclease dna2 from Schizosaccharomyces with 38.41% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC16D10.04c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452537.1) |
Pfam | AAA domain (PF13087.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer