Protein coding transcript 159100

• Transcript: Ll_transcript_242616
• CDS coordinates: 284-706 (+)
• Peptide sequence: MQVSKELVNNGIAVEQIGVITPYNAQANLIRHAACMTSLEIHTIDKYQGRDKDCILVSFVRSSEGPTSSAASLLGDWHRINVALTRAKRKLIMVGSPRTLSKVPLLKLLIKKVERQSGILSVSKKDIFQTGELKRCSQLR*
• ORF Type: complete

Annotations of Ll_transcript_242616

• Blastp: DNA replication ATP-dependent helicase/nuclease dna2 from Schizosaccharomyces with 40.28% of identity
• Blastx: DNA replication ATP-dependent helicase/nuclease dna2 from Schizosaccharomyces with 38.41% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC16D10.04c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452537.1)
• Pfam: AAA domain (PF13087.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;