Protein coding transcript 159201

• Transcript: Ll_transcript_240866
• CDS coordinates: 1-324 (+)
• Peptide sequence: RSPISNLELHHQRYRFEILKSRESGEEIMSNITVCVRFRPLTSKEKPHGDDSVCIRCIDSETFIFKDEKDEELMFSFDKVFYEKSEQVDVYQFLALPIVRDWSWEDI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_240866

• Blastp: Kinesin-like protein KIN-1 from Oryza sativa with 63.01% of identity
• Blastx: Kinesin-like protein KIN-1 from Oryza sativa with 63.01% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (4344521)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440533.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;