Protein coding transcript 159265

• Transcript: Ll_transcript_241638
• CDS coordinates: 236-892 (+)
• Peptide sequence: MDSSSIFYSSNSDFSPESSCFSSPELFSLNFQNDYLPFNENDSEEMLLYGMIASIPQEPFDTTKVVKEEEVSSRGSGDNTRKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSAAILNFPIETVKESLREMNYGSEDGCSPVIALKRKHSLRRKMGIKKNIDSHVRVNNAVVFEDLGADYLEQLLMSSDEIPNPC*
• ORF Type: complete

Annotations of Ll_transcript_241638

• Blastp: Ethylene-responsive transcription factor 1B from Arabidopsis with 65.76% of identity
• Blastx: Ethylene-responsive transcription factor 1B from Arabidopsis with 65.76% of identity
• Eggnog: Transcription factor(ENOG410YJNR)
• Kegg: Link to kegg annotations (AT3G23240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430197.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;