Protein coding transcript 159338

• Transcript: Ll_transcript_242393
• CDS coordinates: 135-461 (+)
• Peptide sequence: MAPKRVLLLCGDFMEDYEVMVPFQALQAYGLTVDAVCPGKKAGDVCRTAVHQLSGHQVSVIFTQPWFFFFFMGFVFVKFCSNYSYMYLISSDFMCNSIHTIGSKSLYK*
• ORF Type: complete

Annotations of Ll_transcript_242393

• Blastp: Protein DJ-1 homolog D from Arabidopsis with 75.86% of identity
• Blastx: Protein DJ-1 homolog D from Arabidopsis with 74.55% of identity
• Eggnog: PfpI family(COG0693)
• Kegg: Link to kegg annotations (AT3G02720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439532.1)
• Pfam: DJ-1/PfpI family (PF01965.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;