Protein coding transcript 159394

• Transcript: Ll_transcript_241392
• CDS coordinates: 1126-1710 (+)
• Peptide sequence: MMVREFHAVIGKETRKQALEKWGGKPDVLIACVGGGSNAMGLFHEFVDDKDVRLIGVEAAGFGLDSGKHAATLTKGEVGVLHGAMSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFLKDLGRAEYYSITDEEALDAFKRVSRLEGIIPALETSHALAYLEKVCPTLPNGTKVVVNFSGRGDKDVQTVIKHLKL*
• ORF Type: complete

Annotations of Ll_transcript_241392

• Blastp: Tryptophan synthase beta chain 2, chloroplastic from Camptotheca with 92.27% of identity
• Blastx: Tryptophan synthase beta chain 2, chloroplastic from Camptotheca with 92.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425870.1)
• Pfam: Pyridoxal-phosphate dependent enzyme (PF00291.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;