Protein coding transcript 159571

• Transcript: Ll_transcript_242874
• CDS coordinates: 80-706 (+)
• Peptide sequence: MVSKNPNSPEGFYLDPSGVTLPGLNPFASVSAAASPMDSAAILSEDAAKKIRKPYTITKSRENWTEPEHDKFLEALQLFDRDWKKIEAFVGSKTAIQIRSHAQKYFLKVQKSGTNEHLPPPRPKRKAAHPYPQKASKNAPVLPLVSAPFESPPALLEPGYILKHDSSAMFKTPIKNTVVPSWSNTTLQATNLSHGIQCYNFQCLEFNL*
• ORF Type: complete

Annotations of Ll_transcript_242874

• Blastp: Protein REVEILLE 6 from Arabidopsis with 57.58% of identity
• Blastx: Protein REVEILLE 6 from Arabidopsis with 57.58% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (AT5G52660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454354.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;