Transcript | Ll_transcript_242902 |
---|---|
CDS coordinates | 1616-1999 (+) |
Peptide sequence | MCSAVPKVNNSCSSSESTLRVRPVGEFNGQGNDSHSLRVLPDFTHVYSFIGSVFDPNVTGHLQKLNKMHRIDVETVLLLMRNLSINLTSPDFEDHRKLLSSYEIELETDNYINAERPLPNEQLKSVT* |
ORF Type | complete |
Blastp | Protein REVEILLE 6 from Arabidopsis with 70.33% of identity |
---|---|
Blastx | Protein REVEILLE 6 from Arabidopsis with 70.33% of identity |
Eggnog | Transcription factor(COG5269) |
Kegg | Link to kegg annotations (AT5G52660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013442632.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer