| Transcript | Ll_transcript_242885 |
|---|---|
| CDS coordinates | 1419-1868 (+) |
| Peptide sequence | MFKTPIKNTVVPSWSNTTLQATNLSHVPKVNNSCSSSESTLRVRPVGEFNGQGNDSHSLRVLPDFTHVYSFIGSVFDPNVTGHLQKLNKMHRIDVETVLLLMRNLSINLTSPDFEDHRKLLSSYEIELETDNYINAERPLPNEQLKSVT* |
| ORF Type | complete |
| Blastp | Protein REVEILLE 6 from Arabidopsis with 53.33% of identity |
|---|---|
| Blastx | Protein REVEILLE 6 from Arabidopsis with 60% of identity |
| Eggnog | Transcription factor(COG5269) |
| Kegg | Link to kegg annotations (AT5G52660) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454354.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer