Protein coding transcript 159631

• Transcript: Ll_transcript_240993
• CDS coordinates: 243-1112 (+)
• Peptide sequence: MTEEESKKFEGLPGVIFVLPDSYVDPVNKQYGGDQYINGTIIPRPPPIQYGRNQRRQDDRRGPSRYNQQGNQMSNPQGNFSYNNRGPTQGDGRNYGPPQNYDQPQQHHGQAASQNFPPQQNYGQASPNYPPQHNYGQASQNYPPQQNYGQASQNYPPQQNHGQAPPNYIPHPQQQGHGPASPQYAQQQNFGPPGQGERRNNVPPQNFGPPGQGQRRDPATRPGGTGAPQSWDNTSFTPSYMKDFKPSYMKEFEQFGKANQGNYPPKEQTDSQQRHPTPGQGNFTGEGRY*
• ORF Type: complete

Annotations of Ll_transcript_240993

• Blastp: Multiple organellar RNA editing factor 1, mitochondrial from Arabidopsis with 46.15% of identity
• Blastx: Multiple organellar RNA editing factor 1, mitochondrial from Arabidopsis with 47.41% of identity
• Eggnog: NA(ENOG410ZPPQ)
• Kegg: Link to kegg annotations (AT4G20020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426169.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;