Protein coding transcript 159700

• Transcript: Ll_transcript_240837
• CDS coordinates: 216-803 (+)
• Peptide sequence: MSLSCTKNFFQRLWIDEFQMGSYAHRSFLSDDLLPSLGAQISQETKLRRYIISPFGPRYRAWEMLLVVLVIYSAWICPFEFAFLPYKPDTLFIIDNIVNGFFAIDILLTFFVAYLDSHSYLLVDDPKKIATRYLYTWFALDVLSTAPFQFVSLIFTNYSSSLGFKVLNILRLWRLRRVSSMFARSGIISYSTLWF*
• ORF Type: complete

Annotations of Ll_transcript_240837

• Blastp: Potassium channel KAT2 from Arabidopsis with 73.91% of identity
• Blastx: Potassium channel KAT2 from Arabidopsis with 73.91% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT4G18290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417979.1)
• Pfam: Ion transport protein (PF00520.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;