Protein coding transcript 159787

• Transcript: Ll_transcript_242478
• CDS coordinates: 2-316 (+)
• Peptide sequence: DWTECPFVHPCENARRRDPVKYQYSCVPCPEFRKGLCSKGDACEYAHGIFECWLHPAQYRTRLCKDESGCTRRVCFFAHKLEELRPLYASTGSALPSPQSYPASA
• ORF Type: internal

Annotations of Ll_transcript_242478

• Blastp: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 85.86% of identity
• Blastx: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 85.86% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410XR0Z)
• Kegg: Link to kegg annotations (AT5G58620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447011.1)
• Pfam: RNA-binding, Nab2-type zinc finger (PF14608.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;