Protein coding transcript 15979

• Transcript: Ll_transcript_412973
• CDS coordinates: 2-943 (+)
• Peptide sequence: GKIKKAMEVFEVVGSKGVKVYNCLLKGLCYVGKVEEALECLMSMKEKKLKNQFLEPDVYSYTAVMDGLCKVGRSDEAMGLLNEAVEMGLVLNVVTFNTLIQGYSREGRPMECVAVLKLMKKHGCVANYVNYSTVLHGLLKWNKVKGALGIYKEMVGLGFEVDVRMMGTLVRRLCKKGLIHDAEEVFEKMLEKGLMVDQRTFEVIVQVLCGRKKIDEALGKLNYMVTLGYFPSVIMFDKVIQCLCAQGRVEEGVSTLLLLHANGRVANRITYDVLIKEFNAQGRLVFASILFSFALKQGVVPNRESLLCKVPFV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_412973

• Blastp: Pentatricopeptide repeat-containing protein At5g64320, mitochondrial from Arabidopsis with 30.43% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g64320, mitochondrial from Arabidopsis with 30.43% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G64320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416406.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;