Protein coding transcript 159790

• Transcript: Ll_transcript_242482
• CDS coordinates: 1-903 (+)
• Peptide sequence: DGVGLWYGRRVGSNKVGYEERTPLMIASTFGSQGVLTYILRTGRVDVNRVTGSDGATALHCAVAGGSAASLEIVKLLLDASADVNTVDANGNRPCDLIFSVANPIFNSKKRMLKTLLEGTHGTYQASLTFEEMVGQIEEQQRQDMNNKPHVSKDGAEKKDYPVDLSLPHIKNGIYSTDEFRMYTFKVKPCSRAYSHDWTECPFVHPGENARRRDPTKYPYSCVPCPEFRVGSCSKGDACEYAHGIFECWLHPAQYRTRLCKDESGCTRRVCFFAHKLEELRPLYASTGSALPSPQSYPASA
• ORF Type: internal

Annotations of Ll_transcript_242482

• Blastp: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 66.44% of identity
• Blastx: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 66.44% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410XR0Z)
• Kegg: Link to kegg annotations (AT5G58620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460513.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;