Protein coding transcript 15986

• Transcript: Ll_transcript_413622
• CDS coordinates: 485-1024 (+)
• Peptide sequence: MGGHARQQLYSLLKDEKGVHFSFGSAQRDGIRKATEGMQSSKFCLNIAGDTPSSNRLFDAIVSHCVPVIISDEIELPYEDVLDYTKFCIFVRTRDALKKKFLINFIRSIGRDEWTRMWSKLKEIENFFEFQFPSKEGDAVQMIWQVVARKVPFIRLKINRSRRFLRSLHGKDMGLKSIL*
• ORF Type: complete

Annotations of Ll_transcript_413622

• Blastp: Probable arabinosyltransferase ARAD1 from Arabidopsis with 46.43% of identity
• Blastx: Probable arabinosyltransferase ARAD1 from Arabidopsis with 45.93% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT2G35100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434864.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;