| Transcript | Ll_transcript_241536 |
|---|---|
| CDS coordinates | 594-980 (+) |
| Peptide sequence | MDEKFQVSEKTKIAISAAEQTVSNAGSAIMKNRYILTGATWVTGAYNKVAKAAEEVGQKTKEKVLAHDNNNNNQGKTEEGQGQGHVQTNITEPQKNTTVDQPSKPESQQNTKPDKPSNPETTTQGLIL* |
| ORF Type | complete |
| Blastp | Binding partner of ACD11 1 from Arabidopsis with 68.75% of identity |
|---|---|
| Blastx | Binding partner of ACD11 1 from Arabidopsis with 62.18% of identity |
| Eggnog | actin cytoskeleton protein(ENOG4111ICI) |
| Kegg | Link to kegg annotations (AT5G16840) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019465180.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer