Transcript | Ll_transcript_240738 |
---|---|
CDS coordinates | 139-546 (+) |
Peptide sequence | MSSMAALRREGKRLAPLIPSQSIRSPLSSPSLDQAPIGARSISTQIVRNRMKSVKNIQKITKAMKMVAASKLRAIQTRAENSRGLWQPFTALLGDTPSVAVKKNVVVTISSDKGLCGGINSTSVKISRGLSKLNSG |
ORF Type | 3prime_partial |
Blastp | ATP synthase subunit gamma, mitochondrial from Ipomoea with 78.42% of identity |
---|---|
Blastx | ATP synthase subunit gamma, mitochondrial from Ipomoea with 76.98% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417641.1) |
Pfam | ATP synthase (PF00231.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer