Transcript | Ll_transcript_240709 |
---|---|
CDS coordinates | 763-1149 (+) |
Peptide sequence | MAMESGPCRGAKRRKSGSVKRFRRQDDDGASKSNPTTVSVEQGQRGVNGDDNNGHMMGDGASAFHIVKIIRPIGYMTSFSSIVDDLSVIFVALRSDGREVTVTNKYLKANNPLLLINYYEENIRYHPM* |
ORF Type | complete |
Blastp | Chromo domain protein LHP1 from Lycopersicon with 42.75% of identity |
---|---|
Blastx | Chromo domain protein LHP1 from Lycopersicon with 34.01% of identity |
Eggnog | chromobox homolog(ENOG4111JKD) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438254.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer