| Transcript | Ll_transcript_240709 |
|---|---|
| CDS coordinates | 763-1149 (+) |
| Peptide sequence | MAMESGPCRGAKRRKSGSVKRFRRQDDDGASKSNPTTVSVEQGQRGVNGDDNNGHMMGDGASAFHIVKIIRPIGYMTSFSSIVDDLSVIFVALRSDGREVTVTNKYLKANNPLLLINYYEENIRYHPM* |
| ORF Type | complete |
| Blastp | Chromo domain protein LHP1 from Lycopersicon with 42.75% of identity |
|---|---|
| Blastx | Chromo domain protein LHP1 from Lycopersicon with 34.01% of identity |
| Eggnog | chromobox homolog(ENOG4111JKD) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438254.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer