Protein coding transcript 1600

• Transcript: Ll_transcript_395135
• CDS coordinates: 3-815 (+)
• Peptide sequence: NEPTFQTLHIAAVAFNSLLLGEIVIPDWDMFYSTHHTAEFHAAARALGGCPVYVSDKPGIHDVNIIRKLVLPDGSILRAKYAGRPTRDCLFDDPVMDGKSLLKIWNLNKLSGIVGIFNCQRAGKWPPTPGETFLSDSVSASLTLRGYISAADVDSLHEVADDDWNGNSVVYAFNSGKLYKLPKGRTIEVSLGVLKCEIFTISPIRVFGPRLEFAPIGLLDMFNSGGATEAIVGSYINQSKYVVKIQVRGCGRFGAYSNIKPSYCVIDKAEE
• ORF Type: internal

Annotations of Ll_transcript_395135

• Blastp: Probable galactinol--sucrose galactosyltransferase 2 from Arabidopsis with 51.2% of identity
• Blastx: Probable galactinol--sucrose galactosyltransferase 2 from Arabidopsis with 51.2% of identity
• Eggnog: raffinose synthase(ENOG410YBU9)
• Kegg: Link to kegg annotations (AT3G57520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416603.1)
• Pfam: Raffinose synthase or seed imbibition protein Sip1 (PF05691.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;