Protein coding transcript 160099

• Transcript: Ll_transcript_242157
• CDS coordinates: 2086-2487 (+)
• Peptide sequence: MQKDYKMFPPSVNWDNINWSTRRPQMDFPVQCVICSLDDVSIIKPGKVKISGYAASGGGRGIERVDVSIDGGKSWIEASRFQKSGIPYITDDDNSDKWAWVLFEVTADILHSTEVIAKAVCNFSSKFHDSTFF*
• ORF Type: complete

Annotations of Ll_transcript_242157

• Blastp: Sulfite oxidase from Arabidopsis with 74.17% of identity
• Blastx: Sulfite oxidase from Arabidopsis with 63.87% of identity
• Eggnog: The exact function is not known. Can catalyze the reduction of a variety of substrates like dimethyl sulfoxide, trimethylamine N-oxide, phenylmethyl sulfoxide and L-methionine sulfoxide. Cannot reduce cyclic N-oxides. Shows no activity as sulfite oxidase (By similarity)(COG2041)
• Kegg: Link to kegg annotations (AT3G01910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453296.1)
• Pfam: Mo-co oxidoreductase dimerisation domain (PF03404.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;