Protein coding transcript 160162

• Transcript: Ll_transcript_242970
• CDS coordinates: 1842-2330 (+)
• Peptide sequence: MFDAVRAKYIIGTVNALQSKPGGGEEWLRSLRKLDLEDVTSALSTLPGVGPKVAACIALFSLDQHHAIPVDTHVWQIATKYLLPELAGSRLTPKLCNRVAEAFVTKYGKYAGWAQTLLFIAELPSQKVLLPSHLCTIDQHNHTKKEDSEILANSTDGMDLRI*
• ORF Type: complete

Annotations of Ll_transcript_242970

• Blastp: N-glycosylase/DNA lyase OGG1 from Arabidopsis with 70.59% of identity
• Blastx: N-glycosylase/DNA lyase OGG1 from Arabidopsis with 65.34% of identity
• Eggnog: Glycosylase(COG0122)
• Kegg: Link to kegg annotations (AT1G21710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438584.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;