Transcript | Ll_transcript_241949 |
---|---|
CDS coordinates | 351-875 (+) |
Peptide sequence | MNRRIVLAIYFFIFFNLVLITFSQDSLVKEDSGGSVDLGRRGKIVNNQEDDGWNSGGVDLGLEAGLGVFDAFFASLSMILVSEIGDETFIIAALMAMRHPKSIVLSGALSALVIMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRLLYIAWRSSDSKSSQKKEMEEAPMF* |
ORF Type | complete |
Blastp | GDT1-like protein 3 from Arabidopsis with 63.22% of identity |
---|---|
Blastx | GDT1-like protein 3 from Arabidopsis with 63.22% of identity |
Eggnog | transmembrane protein 165(COG2119) |
Kegg | Link to kegg annotations (AT5G36290) |
CantataDB | Link to cantataDB annotations (CNT0002327) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431928.1) |
Pfam | Uncharacterized protein family UPF0016 (PF01169.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer