Protein coding transcript 160197

• Transcript: Ll_transcript_241957
• CDS coordinates: 351-875 (+)
• Peptide sequence: MNRRIVLAIYFFIFFNLVLITFSQDSLVKEDSGGSVDLGRRGKIVNNQEDDGWNSGGVDLGLEAGLGVFDAFFASLSMILVSEIGDETFIIAALMAMRHPKSIVLSGALSALVIMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFGLRLLYIAWRSSDSKSSQKKEMEEAPMF*
• ORF Type: complete

Annotations of Ll_transcript_241957

• Blastp: GDT1-like protein 3 from Arabidopsis with 63.22% of identity
• Blastx: GDT1-like protein 3 from Arabidopsis with 63.22% of identity
• Eggnog: transmembrane protein 165(COG2119)
• Kegg: Link to kegg annotations (AT5G36290)
• CantataDB: Link to cantataDB annotations (CNT0002327)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431928.1)
• Pfam: Uncharacterized protein family UPF0016 (PF01169.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;