Protein coding transcript 160223

• Transcript: Ll_transcript_241967
• CDS coordinates: 683-991 (+)
• Peptide sequence: MLQRSLIEAIVDLLASDGKVFLQSDVEAVAISMKEQFLRYGKGKLDLVHGQNEWLEENPFGVRSDWEKHVLERGAPMYRMMFSKSSDISEVSAANDVIQKDD*
• ORF Type: complete

Annotations of Ll_transcript_241967

• Blastp: tRNA (guanine-N(7)-)-methyltransferase from Nostoc with 40.7% of identity
• Blastx: tRNA (guanine-N(7)-)-methyltransferase from Nostoc with 39.22% of identity
• Eggnog: Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (By similarity)(COG0220)
• Kegg: Link to kegg annotations (alr1845)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442815.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;