Transcript | Ll_transcript_241970 |
---|---|
CDS coordinates | 600-908 (+) |
Peptide sequence | MLQRSLIEAIVDLLASDGKVFLQSDVEAVAISMKEQFLRYGKGKLDLVHGQNEWLEENPFGVRSDWEKHVLERGAPMYRMMFSKSSDISEVSAANDVIQKDD* |
ORF Type | complete |
Blastp | tRNA (guanine-N(7)-)-methyltransferase from Nostoc with 40.7% of identity |
---|---|
Blastx | tRNA (guanine-N(7)-)-methyltransferase from Nostoc with 39.39% of identity |
Eggnog | Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (By similarity)(COG0220) |
Kegg | Link to kegg annotations (alr1845) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442815.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer