Protein coding transcript 16023

• Transcript: Ll_transcript_413549
• CDS coordinates: 79-759 (+)
• Peptide sequence: MEKSNLRIIVSSLFMVLCMFITLSIVAPKAEARAFFVFGDSLVDNGNNNYLATTARADSYPYGIDSATHRASGRFSNGLNIPDLISEKIGSEPTLPYLSPELNGEKLLVGANFASAGIGILNDTGIQFINIIRITNQLLYFREYQQRVSALIGEKQTKDLVNQALVLITLGGNDFVNNYYLVPFSARSREFNLPNYVVFLISEYRKILVVILSFLLLSLEYYYHNL*
• ORF Type: complete

Annotations of Ll_transcript_413549

• Blastp: GDSL esterase/lipase LTL1 from Arabidopsis with 71.92% of identity
• Blastx: GDSL esterase/lipase LTL1 from Arabidopsis with 71.64% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT3G04290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448449.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;