Protein coding transcript 160232

• Transcript: Ll_transcript_242006
• CDS coordinates: 308-1360 (+)
• Peptide sequence: MNKKRHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERDVTLVIPWLTLKDQGLVYPNDITFSSPSEHEKYIRQWLDERVGFTPGFSIQFYPGKFSKDKRSILAVGDISEIIPDEKADIAVLEEPEHLTWYHHGKRWKTKFRLVIGIIHTNYLEYVKREKNGMLASFLLKYLNNWVVGIYCHKVIRLSAATQDYDGSIICNVHGVNPKFLEIGKKKREQQQNGDKAFTKGAYFIGKMVWSKGYKELLQLLRDHQKELTELEVDLFGSGEDSNEVQDAAKKLDLAIRVHPARDHADSQFHDYKLFLNPSTTDVVCTTTAEALAMGKIIVCANHCSNDFFKQFTNCWTYDDSD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_242006

• Blastp: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88.57% of identity
• Blastx: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88.57% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461398.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;