Transcript | Ll_transcript_242006 |
---|---|
CDS coordinates | 308-1360 (+) |
Peptide sequence | MNKKRHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERDVTLVIPWLTLKDQGLVYPNDITFSSPSEHEKYIRQWLDERVGFTPGFSIQFYPGKFSKDKRSILAVGDISEIIPDEKADIAVLEEPEHLTWYHHGKRWKTKFRLVIGIIHTNYLEYVKREKNGMLASFLLKYLNNWVVGIYCHKVIRLSAATQDYDGSIICNVHGVNPKFLEIGKKKREQQQNGDKAFTKGAYFIGKMVWSKGYKELLQLLRDHQKELTELEVDLFGSGEDSNEVQDAAKKLDLAIRVHPARDHADSQFHDYKLFLNPSTTDVVCTTTAEALAMGKIIVCANHCSNDFFKQFTNCWTYDDSD |
ORF Type | 3prime_partial |
Blastp | Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88.57% of identity |
---|---|
Blastx | Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88.57% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461398.1) |
Pfam | Glycosyl transferases group 1 (PF00534.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer