Protein coding transcript 160233

• Transcript: Ll_transcript_242008
• CDS coordinates: 1637-2110 (+)
• Peptide sequence: MQVIRLSAATQDYDGSIICNVHGVNPKFLEIGKKKREQQQNGDKAFTKGAYFIGKMVWSKGYKELLQLLRDHQKELTELEVDLFGSGEDSNEVQDAAKKLDLAIRVHPARDHADSQFHDYKLFLNPSTTDVVCTTTAEALAMGKIIVCANHCSNDFF*
• ORF Type: complete

Annotations of Ll_transcript_242008

• Blastp: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 87.82% of identity
• Blastx: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 87.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461398.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;