Transcript | Ll_transcript_242008 |
---|---|
CDS coordinates | 1637-2110 (+) |
Peptide sequence | MQVIRLSAATQDYDGSIICNVHGVNPKFLEIGKKKREQQQNGDKAFTKGAYFIGKMVWSKGYKELLQLLRDHQKELTELEVDLFGSGEDSNEVQDAAKKLDLAIRVHPARDHADSQFHDYKLFLNPSTTDVVCTTTAEALAMGKIIVCANHCSNDFF* |
ORF Type | complete |
Blastp | Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 87.82% of identity |
---|---|
Blastx | Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 87.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461398.1) |
Pfam | Glycosyl transferases group 1 (PF00534.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer