Protein coding transcript 160241

• Transcript: Ll_transcript_242002
• CDS coordinates: 162-1064 (+)
• Peptide sequence: MDKKQHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERDVTLAIPWLTLEDQALVYPNNITFSSPSEHEKYIRQWLEERVGFRLGFNILFYPGKFSKDKRSILAVGDISEIIPDEEADIAVLEEPEHLTWYHHGKRWKTKFRLVVGIIHTNYLEYVKREKNGMLASFLLKYLNNWVVGIYCHKVIRLSAATQDYDGSIICNVHGVNPKFLEIGKKKREQQQNGDKAFTKGAYFIGKMVWSKGYKELLQLLRDHQKELTELEVDLFGSGEDSNEVQDAAKKLDLAIRVHPARDHADSQFHE*
• ORF Type: complete

Annotations of Ll_transcript_242002

• Blastp: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88% of identity
• Blastx: Digalactosyldiacylglycerol synthase 2, chloroplastic from Lotus with 88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413860.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;