Transcript | Ll_transcript_413561 |
---|---|
CDS coordinates | 79-759 (+) |
Peptide sequence | MEKSNLRIIVSSLFMVLCMFITLSIVAPKAEARAFFVFGDSLVDNGNNNYLATTARADSYPYGIDSATHRASGRFSNGLNIPDLISEKIGSEPTLPYLSPELNGEKLLVGANFASAGIGILNDTGIQFINIIRITNQLLYFREYQQRVSALIGEKQTKDLVNQALVLITLGGNDFVNNYYLVPFSARSREFNLPNYVVFLISEYRKILVVILSFLLLSLEYYYHNL* |
ORF Type | complete |
Blastp | GDSL esterase/lipase LTL1 from Arabidopsis with 71.92% of identity |
---|---|
Blastx | GDSL esterase/lipase LTL1 from Arabidopsis with 71.64% of identity |
Eggnog | GDSL esterase lipase(COG3240) |
Kegg | Link to kegg annotations (AT3G04290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448449.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer