Protein coding transcript 16031

• Transcript: Ll_transcript_413564
• CDS coordinates: 3-428 (+)
• Peptide sequence: KKWKCDKCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDVLAEESARGTIPNHHSSLLQSSHLQIHDHQDNNIHAINNIFSLKKEQQSFSLISPQIMPQWLGPQSNNNNNNNNNTLDLSSTSSIFSHHH
• ORF Type: internal

Annotations of Ll_transcript_413564

• Blastp: Protein indeterminate-domain 1 from Arabidopsis with 46.41% of identity
• Blastx: Protein indeterminate-domain 7 from Arabidopsis with 87.04% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G66730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458609.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;