Protein coding transcript 160374

• Transcript: Ll_transcript_243043
• CDS coordinates: 4804-5265 (+)
• Peptide sequence: MQFFGGSEISPSPPAPAASGNNGHMMYVFNRNGICLLYREWNRSLRTLNAQQDHKLMFGLLFSLKSLTAKMDPTSAEKGNLGVPQLPGQGCSFHSFRTNTYKLSFMESPSGIKIILVTHPRTGDLRESLKYIYNLYVEYVVKNPLYTPGSPIR*
• ORF Type: complete

Annotations of Ll_transcript_243043

• Blastp: Trafficking protein particle complex subunit 1 from Dictyostelium with 37.21% of identity
• Blastx: Trafficking protein particle complex subunit 1 from Dictyostelium with 37.21% of identity
• Eggnog: trafficking protein particle complex(ENOG4111X41)
• Kegg: Link to kegg annotations (DDB_G0273467)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449715.1)
• Pfam: Sybindin-like family (PF04099.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;