Protein coding transcript 160431

• Transcript: Ll_transcript_241798
• CDS coordinates: 126-968 (+)
• Peptide sequence: MKNPHILLLSVSLPTPSSETIFVRGLPFGAIEAIKAAYGVLVQILDPPRDGFNLTLKINLAKLPANQEQKHAFLVKVASVREVVLGAPLRVVLKHLASRTLARDVDPLVALVHRPKESFFLVPQANKVTVVYPMRFNDSIDIALATSFLQEFVEARRTAGLNNTPPCSWSYTPPLELKGVSADALSANAGFVTFVIFPRHVEGQKLDRTVWNLSTFHAYVSYHVKCSEGFMHTRMRRRVESLIQALDSAKSDLENAKKTTSQNRSFKRLSLKDSRVDSFS*
• ORF Type: complete

Annotations of Ll_transcript_241798

• Blastp: Actin-related protein 2/3 complex subunit 2A from Arabidopsis with 68.5% of identity
• Blastx: Actin-related protein 2/3 complex subunit 2A from Arabidopsis with 68.36% of identity
• Eggnog: protein 2 3 complex subunit(ENOG410YKF6)
• Kegg: Link to kegg annotations (AT1G30825)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446964.1)
• Pfam: Arp2/3 complex, 34 kD subunit p34-Arc (PF04045.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;