Transcript | Ll_transcript_413457 |
---|---|
CDS coordinates | 66-965 (+) |
Peptide sequence | MEENGKIRSLDATPTWAVATVITIMVSLSFMFQITLEKFGKWLDRTKRKSMLSALEKVKEELMLFGLLSLLMGHWTIFVAKICVKASVLKTRFIPCAIEKNSGTVEHIFWPSSEYSNRTILQENVNNGLHNYCPKGKESFASYESLEQLHSLLFILGVTHVFYSFIAVGLAMIKIYSWRIWENEAKIIATQNTLNVRLSRLGTFIFHHTSHPWSDHKILVWLLCFSRQFWSSINRADYMALRFGFITNHELPLNYDFHNYMLRSMDEEFRDIVGISVPLWIYAICCIILNFHADPNNWY* |
ORF Type | complete |
Blastp | MLO-like protein 4 from Arabidopsis with 47.4% of identity |
---|---|
Blastx | MLO-like protein 4 from Arabidopsis with 47.4% of identity |
Eggnog | May be involved in modulation of pathogen defense and leaf cell death (By similarity)(ENOG410YDUG) |
Kegg | Link to kegg annotations (AT1G11000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444838.1) |
Pfam | Mlo family (PF03094.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer