Protein coding transcript 1605

• Transcript: Ll_transcript_395126
• CDS coordinates: 158-1282 (+)
• Peptide sequence: MDQKCNVSLLDAKKNIPAPPPLPRSMATAFRCKAEKNDPPPRRHSNVSSATRDLWEGLYNEGYKADVYISTDNGGIIYAHSIILAKASPVLKGMLKQANRHHHWRPISIFGVPHDAVRVFVRYLYSSCYEKEEMEQFTLHLLVLSHVFVVPQLKHECQQKLELDFLTIDKVVDLLQLSLLCDSPRLVLICRRKILQYFKVVSESEGWKVMKQSHPVLEKELLESLVEEENRKTKNMRRKNERMIYRKLYEAMDALVHIFSDGCRTIGPHDKDFKANQAPCCYAACKGLELLVHHFSGCKLRLQGSCVHCKRMLQVLELHSRLCVDPDQCRVPLCRKFKQGISRQRKKDNVKWKILVEKIFRTRGTVLAPCFQRQ*
• ORF Type: complete

Annotations of Ll_transcript_395126

• Blastp: BTB/POZ and TAZ domain-containing protein 4 from Arabidopsis with 57.66% of identity
• Blastx: BTB/POZ and TAZ domain-containing protein 4 from Arabidopsis with 57.66% of identity
• Eggnog: BTB POZ and TAZ domain-containing protein(ENOG410Z8TC)
• Kegg: Link to kegg annotations (AT5G67480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423962.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;