Protein coding transcript 160540

• Transcript: Ll_transcript_240952
• CDS coordinates: 252-686 (+)
• Peptide sequence: MEENWAEGKRTLEYEDEEEEEEMMSYGEDHGRNKKRVVVTTDLYSSKRGSKAGGSVPPCCQVDSCKTDLSDAKQYHKRHKVCEYHAKAPSVLIADQHQRFCQQCSRFHVLTEFDESKRSCRRRLAGHNERRRKNAAEYHGEGFH*
• ORF Type: complete

Annotations of Ll_transcript_240952

• Blastp: Squamosa promoter-binding protein 1 from Antirrhinum with 52.14% of identity
• Blastx: Squamosa promoter-binding-like protein 3 from Arabidopsis with 72.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440237.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;