Transcript | Ll_transcript_240953 |
---|---|
CDS coordinates | 2-595 (+) |
Peptide sequence | FYYPHLATNKWRNPMWSSPILSHSIYLPFSFFYLYKGFMVFFSITFFHFPEPIMEGNWAEGKRTLEYDDEEDEEDEVISEIMSNGDEGRNKKRAVTKDLYRSKRGSKAGGSVAPSCQVDSCKTDLSDAKQYHRRHKVCEYHAKAPFVLIADHQQRFCQQCSRFHEVSEFDESKRSCRRRLAGHNERRRKNAADYHGE* |
ORF Type | 5prime_partial |
Blastp | Squamosa promoter-binding protein 1 from Antirrhinum with 54.17% of identity |
---|---|
Blastx | Squamosa promoter-binding protein 1 from Antirrhinum with 52.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418278.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer