Protein coding transcript 160542

• Transcript: Ll_transcript_240954
• CDS coordinates: 199-570 (+)
• Peptide sequence: MEGNWAEGKKTLEYEDEEEEEEGVSERMSYGEERMNKKRVVSTDLYSSKRGSKAGGSVPPSCQVDSCKTDLSDAKNYHRRHKVCEYHAKAPSVLIADQQQRFCQQCSRFHELSEFDDTKRSCRR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_240954

• Blastp: Squamosa promoter-binding protein 1 from Antirrhinum with 48.39% of identity
• Blastx: Squamosa promoter-binding protein 1 from Antirrhinum with 68.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425272.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;